SCOPe 2.07: Domain d1nvje_: 1nvj E:

Lineage for d1nvje_ (1nvj E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
   automatically mapped to Pfam PF02391

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)

8. Domain d1nvje_: 1nvj E: [86247]
   complexed with fmt, gol, na; mutant

Details for d1nvje_

PDB Entry: 1nvj, 2.15 Å

PDB Description: Deletion Mutant (Delta 141) of Molybdopterin Synthase

PDB Compounds: (E:) Molybdopterin converting factor subunit 2

SCOPe Domain Sequences for d1nvje_:

Sequence, based on SEQRES records:

>d1nvje_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwk

Sequence, based on observed residues (ATOM records):

>d1nvje_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwk

Timeline for d1nvje_:

• d1nvje_ first appeared in SCOP 1.65
  
• d1nvje_ appears in SCOPe 2.06
  
• d1nvje_ appears in the current release, SCOPe 2.08