SCOP 1.67: Domain d1nvjc_: 1nvj C:

Lineage for d1nvjc_ (1nvj C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (4 PDB entries)

8. Domain d1nvjc_: 1nvj C: [86245]

Details for d1nvjc_

PDB Entry: 1nvj, 2.15 Å

PDB Description: Deletion Mutant (Delta 141) of Molybdopterin Synthase

SCOP Domain Sequences for d1nvjc_:

Sequence, based on SEQRES records:

>d1nvjc_ d.41.5.1 (C:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkre

Sequence, based on observed residues (ATOM records):

>d1nvjc_ d.41.5.1 (C:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgnaltlehypgmtekala
eivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapf
wkre

Timeline for d1nvjc_:

• d1nvjc_ first appeared in SCOP 1.65
  
• d1nvjc_ appears in SCOP 1.69
  
• d1nvjc_ appears in the current release, SCOPe 2.08