| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family) ![]() |
| Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein) |
| Protein Molybdopterin synthase subunit MoaE [54692] (1 species) |
| Species Escherichia coli [TaxId:562] [54693] (4 PDB entries) |
| Domain d1nvjb_: 1nvj B: [86244] |
PDB Entry: 1nvj (more details), 2.15 Å
SCOP Domain Sequences for d1nvjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvjb_ d.41.5.1 (B:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkr
Timeline for d1nvjb_: