Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries) |
Domain d1nugb1: 1nug B:1-140 [86190] Other proteins in same PDB: d1nuga2, d1nuga3, d1nuga4, d1nugb2, d1nugb3, d1nugb4 complexed with ca, cl, mg |
PDB Entry: 1nug (more details), 2.4 Å
SCOPe Domain Sequences for d1nugb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nugb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg gissvklgtfillfnpwlnv
Timeline for d1nugb1:
View in 3D Domains from other chains: (mouse over for more information) d1nuga1, d1nuga2, d1nuga3, d1nuga4 |