Lineage for d1nu2a_ (1nu2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803370Protein Disabled homolog 1 (Dab1) [89357] (1 species)
  7. 2803371Species Mouse (Mus musculus) [TaxId:10090] [89358] (3 PDB entries)
  8. 2803373Domain d1nu2a_: 1nu2 A: [86169]
    complexed with apoer2 peptide and PI-4,5P2
    complexed with i3p
    has additional insertions and/or extensions that are not grouped together

Details for d1nu2a_

PDB Entry: 1nu2 (more details), 1.9 Å

PDB Description: crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
PDB Compounds: (A:) Disabled homolog 1

SCOPe Domain Sequences for d1nu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu2a_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]}
gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
taqaaepvildlrdlfqliyelkqreelekka

SCOPe Domain Coordinates for d1nu2a_:

Click to download the PDB-style file with coordinates for d1nu2a_.
(The format of our PDB-style files is described here.)

Timeline for d1nu2a_: