Lineage for d1ntgb_ (1ntg B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541449Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1541450Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species)
    EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity
  7. 1541451Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry)
  8. 1541453Domain d1ntgb_: 1ntg B: [86165]

Details for d1ntgb_

PDB Entry: 1ntg (more details), 2.21 Å

PDB Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1ntgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntgb_ b.40.4.4 (B:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]}
peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle

SCOPe Domain Coordinates for d1ntgb_:

Click to download the PDB-style file with coordinates for d1ntgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ntgb_: