Lineage for d1nt0g2 (1nt0 G:165-278)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041738Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041739Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2041740Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 protein domains)
  6. 2041764Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 2041769Species Norway rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry)
  8. 2041773Domain d1nt0g2: 1nt0 G:165-278 [86147]
    Other proteins in same PDB: d1nt0a3, d1nt0g3
    complexed with ca, edo, nag

Details for d1nt0g2

PDB Entry: 1nt0 (more details), 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2
PDB Compounds: (G:) mannose-binding protein associated serine protease-2

SCOPe Domain Sequences for d1nt0g2:

Sequence, based on SEQRES records: (download)

>d1nt0g2 b.23.1.1 (G:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy
dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

Sequence, based on observed residues (ATOM records): (download)

>d1nt0g2 b.23.1.1 (G:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhcdslkiq
tdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

SCOPe Domain Coordinates for d1nt0g2:

Click to download the PDB-style file with coordinates for d1nt0g2.
(The format of our PDB-style files is described here.)

Timeline for d1nt0g2: