Class b: All beta proteins [48724] (180 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species) duplication: contains two CUB domains separated by an EGF-like domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry) |
Domain d1nt0g1: 1nt0 G:5-119 [86146] Other proteins in same PDB: d1nt0a3, d1nt0g3 complexed with ca, edo, nag |
PDB Entry: 1nt0 (more details), 2.7 Å
SCOPe Domain Sequences for d1nt0g1:
Sequence, based on SEQRES records: (download)
>d1nt0g1 b.23.1.1 (G:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt kvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed
>d1nt0g1 b.23.1.1 (G:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaed
Timeline for d1nt0g1: