Lineage for d1nrvb_ (1nrv B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332335Protein Growth factor receptor-bound protein 10, GRB10 [89994] (1 species)
  7. 332336Species Human (Homo sapiens) [TaxId:9606] [89995] (1 PDB entry)
  8. 332338Domain d1nrvb_: 1nrv B: [86127]

Details for d1nrvb_

PDB Entry: 1nrv (more details), 1.65 Å

PDB Description: Crystal structure of the SH2 domain of Grb10

SCOP Domain Sequences for d1nrvb_:

Sequence, based on SEQRES records: (download)

>d1nrvb_ d.93.1.1 (B:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens)}
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ceddgqtffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcir

Sequence, based on observed residues (ATOM records): (download)

>d1nrvb_ d.93.1.1 (B:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens)}
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ctffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcir

SCOP Domain Coordinates for d1nrvb_:

Click to download the PDB-style file with coordinates for d1nrvb_.
(The format of our PDB-style files is described here.)

Timeline for d1nrvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrva_