SCOP 1.71: Domain d1nqca_: 1nqc A:

Lineage for d1nqca_ (1nqc A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (4 PDB entries)

8. Domain d1nqca_: 1nqc A: [86024]
   complexed with c4p

Details for d1nqca_

PDB Entry: 1nqc, 1.8 Å

PDB Description: crystal structures of cathepsin s inhibitor complexes

SCOP Domain Sequences for d1nqca_:

Sequence; same for both SEQRES and ATOM records:

>d1nqca_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens)}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvtlsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d1nqca_:

• d1nqca_ first appeared in SCOP 1.65
  
• d1nqca_ appears in SCOP 1.69
  
• d1nqca_ appears in SCOP 1.73
  
• d1nqca_ appears in the current release, SCOPe 2.08