Lineage for d1nneb3 (1nne B:1121-1266)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2140751Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2140752Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 2140753Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 2140770Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries)
  8. 2140776Domain d1nneb3: 1nne B:1121-1266 [85901]
    Other proteins in same PDB: d1nnea1, d1nnea2, d1nnea4, d1nneb1, d1nneb2, d1nneb4
    protein/DNA complex; complexed with adp, bef, edo, so4

Details for d1nneb3

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1nneb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nneb3 c.55.6.1 (B:1121-1266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
frfydpgafmrlpeatlralevfepl

SCOPe Domain Coordinates for d1nneb3:

Click to download the PDB-style file with coordinates for d1nneb3.
(The format of our PDB-style files is described here.)

Timeline for d1nneb3: