Lineage for d1nn6a_ (1nn6 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545731Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 1545732Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)
  8. 1545736Domain d1nn6a_: 1nn6 A: [85893]
    proenzyme
    complexed with nag

Details for d1nn6a_

PDB Entry: 1nn6 (more details), 1.75 Å

PDB Description: human pro-chymase
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1nn6a_:

Sequence, based on SEQRES records: (download)

>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
ggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahnite
eedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppgrm
crvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgds
ggpllcagvaqgivsygrsdakppavftrishyrpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
ggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahnite
eedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppgrm
crvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktafkgdsgg
pllcagvaqgivsygrsdakppavftrishyrpwinqilqan

SCOPe Domain Coordinates for d1nn6a_:

Click to download the PDB-style file with coordinates for d1nn6a_.
(The format of our PDB-style files is described here.)

Timeline for d1nn6a_: