Lineage for d1nn4c_ (1nn4 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885147Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1885148Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1885149Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 1885150Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 1885151Species Escherichia coli [TaxId:562] [89626] (1 PDB entry)
  8. 1885154Domain d1nn4c_: 1nn4 C: [85890]
    structural genomics

Details for d1nn4c_

PDB Entry: 1nn4 (more details), 2.2 Å

PDB Description: structural genomics, rpib/alsb
PDB Compounds: (C:) Ribose 5-phosphate isomerase B

SCOPe Domain Sequences for d1nn4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn4c_ c.121.1.1 (C:) Alternate ribose 5-phosphate isomerase B, RpiB {Escherichia coli [TaxId: 562]}
hhhssgltprgsqmkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphya
sqvalavaggevdggilicgtgvgisiaankfagiravvcsepysaqlsrqhndtnvlaf
gsrvvglelakmivdawlgaqyeggrhqqrveaitaieq

SCOPe Domain Coordinates for d1nn4c_:

Click to download the PDB-style file with coordinates for d1nn4c_.
(The format of our PDB-style files is described here.)

Timeline for d1nn4c_: