Lineage for d1nn4c1 (1nn4 C:1-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2921987Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 2921988Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 2921989Species Escherichia coli [TaxId:562] [89626] (1 PDB entry)
  8. 2921992Domain d1nn4c1: 1nn4 C:1-146 [85890]
    Other proteins in same PDB: d1nn4a2, d1nn4b2, d1nn4c2, d1nn4d2
    structural genomics

Details for d1nn4c1

PDB Entry: 1nn4 (more details), 2.2 Å

PDB Description: structural genomics, rpib/alsb
PDB Compounds: (C:) Ribose 5-phosphate isomerase B

SCOPe Domain Sequences for d1nn4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn4c1 c.121.1.1 (C:1-146) Alternate ribose 5-phosphate isomerase B, RpiB {Escherichia coli [TaxId: 562]}
mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd
ggilicgtgvgisiaankfagiravvcsepysaqlsrqhndtnvlafgsrvvglelakmi
vdawlgaqyeggrhqqrveaitaieq

SCOPe Domain Coordinates for d1nn4c1:

Click to download the PDB-style file with coordinates for d1nn4c1.
(The format of our PDB-style files is described here.)

Timeline for d1nn4c1: