SCOPe 2.08: Domain d1nlqc_: 1nlq C:

Lineage for d1nlqc_ (1nlq C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families)
   oligomerizes into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
   automatically mapped to Pfam PF03066

6. Protein Chromatin decondensation protein 1 (Crp1, Nlp) [89223] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89224] (1 PDB entry)

8. Domain d1nlqc_: 1nlq C: [85855]
   complexed with mg

Details for d1nlqc_

PDB Entry: 1nlq, 1.5 Å

PDB Description: The crystal structure of Drosophila NLP-core provides insight into pentamer formation and histone binding

PDB Compounds: (C:) Nucleoplasmin-like protein

SCOPe Domain Sequences for d1nlqc_:

Sequence, based on SEQRES records:

>d1nlqc_ b.121.3.1 (C:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
esfygvtltaesdsvtwdvdedyargqklvikqillgaeakenefnvvevntpkdsvqip
iavlkagetravnpdvefyeskvtfklikgsgpvyihghnik

Sequence, based on observed residues (ATOM records):

>d1nlqc_ b.121.3.1 (C:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
esfygvtltaesdsvtwdvgqklvikqillgaeakenefnvvevntpkdsvqipiavlka
getravnpdvefyeskvtfklikgsgpvyihghnik

Timeline for d1nlqc_:

• d1nlqc_ first appeared in SCOP 1.65
  
• d1nlqc_ appears in SCOPe 2.07