Lineage for d1nkua_ (1nku A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742126Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1742127Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 1742237Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
    automatically mapped to Pfam PF03352
  6. 1742238Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)
  7. 1742239Species Escherichia coli [TaxId:562] [74758] (3 PDB entries)
  8. 1742240Domain d1nkua_: 1nku A: [85838]
    complexed with zn

Details for d1nkua_

PDB Entry: 1nku (more details)

PDB Description: nmr solution structure of zinc-binding protein 3-methyladenine dna glycosylase i (tag)
PDB Compounds: (A:) 3-Methyladenine Dna Glycosylase I (TAG)

SCOPe Domain Sequences for d1nkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkua_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]}
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp

SCOPe Domain Coordinates for d1nkua_:

Click to download the PDB-style file with coordinates for d1nkua_.
(The format of our PDB-style files is described here.)

Timeline for d1nkua_: