| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species) contains additional alpha-helical domain after the family specific domains |
| Species Escherichia coli [TaxId:562] [52712] (6 PDB entries) Uniprot P28631 |
| Domain d1njgb_: 1njg B: [85786] AAA+ domain only; nucleotide-free form complexed with so4, zn |
PDB Entry: 1njg (more details), 2.2 Å
SCOPe Domain Sequences for d1njgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njgb_ c.37.1.20 (B:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
Timeline for d1njgb_: