SCOP 1.65: Domain d1njgb_: 1njg B:

Lineage for d1njgb_ (1njg B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (15 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Escherichia coli [TaxId:562] [52712] (4 PDB entries)

8. Domain d1njgb_: 1njg B: [85786]
   AAA+ domain only; nucleotide-free form
   complexed with so4, zn

Details for d1njgb_

PDB Entry: 1njg, 2.2 Å

PDB Description: Nucleotide-free form of an Isolated E. coli Clamp Loader Gamma Subunit

SCOP Domain Sequences for d1njgb_:

Sequence; same for both SEQRES and ATOM records:

>d1njgb_ c.37.1.20 (B:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt

Timeline for d1njgb_:

• d1njgb_ is new in SCOP 1.65
  
• d1njgb_ appears in SCOP 1.67
  
• d1njgb_ appears in the current release, SCOPe 2.08