Lineage for d1nj8b2 (1nj8 B:394-455)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656450Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 1656451Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 1656452Protein C-terminal domain of ProRS [64588] (3 species)
  7. 1656453Species Methanocaldococcus jannaschii [TaxId:2190] [89974] (1 PDB entry)
  8. 1656455Domain d1nj8b2: 1nj8 B:394-455 [85773]
    Other proteins in same PDB: d1nj8a1, d1nj8a3, d1nj8b1, d1nj8b3, d1nj8c1, d1nj8c3, d1nj8d1, d1nj8d3

Details for d1nj8b2

PDB Entry: 1nj8 (more details), 3.2 Å

PDB Description: Crystal Structure of Prolyl-tRNA Synthetase from Methanocaldococcus janaschii
PDB Compounds: (B:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj8b2 d.68.5.1 (B:394-455) C-terminal domain of ProRS {Methanocaldococcus jannaschii [TaxId: 2190]}
itiledinpdeiknilsekrgvilvpfkeeiyneeleekveatilgeteykgnkyiaiak
ty

SCOPe Domain Coordinates for d1nj8b2:

Click to download the PDB-style file with coordinates for d1nj8b2.
(The format of our PDB-style files is described here.)

Timeline for d1nj8b2: