Lineage for d1nj5a2 (1nj5 A:411-481)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656450Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 1656451Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 1656452Protein C-terminal domain of ProRS [64588] (3 species)
  7. 1656458Species Methanothermobacter thermautotrophicus [TaxId:145262] [89973] (4 PDB entries)
  8. 1656460Domain d1nj5a2: 1nj5 A:411-481 [85763]
    Other proteins in same PDB: d1nj5a1, d1nj5a3
    protein/RNA complex; complexed with mg, p5a, zn

Details for d1nj5a2

PDB Entry: 1nj5 (more details), 2.8 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to proline sulfamoyl adenylate
PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj5a2 d.68.5.1 (A:411-481) C-terminal domain of ProRS {Methanothermobacter thermautotrophicus [TaxId: 145262]}
ireaetleeasrivdekrgiisfmwcgeeecgmdveekvrvdilgiqeegsgtcincgre
apyraylarty

SCOPe Domain Coordinates for d1nj5a2:

Click to download the PDB-style file with coordinates for d1nj5a2.
(The format of our PDB-style files is described here.)

Timeline for d1nj5a2: