Lineage for d1nj5a1 (1nj5 A:284-410)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856158Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 1856159Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1856205Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 1856211Species Methanothermobacter thermautotrophicus [TaxId:145262] [89714] (4 PDB entries)
  8. 1856213Domain d1nj5a1: 1nj5 A:284-410 [85762]
    Other proteins in same PDB: d1nj5a2, d1nj5a3
    protein/RNA complex; complexed with mg, p5a, zn

Details for d1nj5a1

PDB Entry: 1nj5 (more details), 2.8 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to proline sulfamoyl adenylate
PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj5a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

SCOPe Domain Coordinates for d1nj5a1:

Click to download the PDB-style file with coordinates for d1nj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj5a1: