| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest  | 
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]()  | 
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) | 
| Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) | 
| Species Methanothermobacter thermautotrophicus [TaxId:145262] [89714] (4 PDB entries) | 
| Domain d1nj5a1: 1nj5 A:284-410 [85762] Other proteins in same PDB: d1nj5a2, d1nj5a3 protein/RNA complex; complexed with mg, p5a, zn  | 
PDB Entry: 1nj5 (more details), 2.8 Å
SCOPe Domain Sequences for d1nj5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj5a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese
Timeline for d1nj5a1: