Lineage for d1nj5a1 (1nj5 A:284-410)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316209Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 316210Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 316246Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 316252Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [89714] (4 PDB entries)
  8. 316254Domain d1nj5a1: 1nj5 A:284-410 [85762]
    Other proteins in same PDB: d1nj5a2, d1nj5a3
    complexed with mg, p5a, zn

Details for d1nj5a1

PDB Entry: 1nj5 (more details), 2.8 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to proline sulfamoyl adenylate

SCOP Domain Sequences for d1nj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj5a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus)}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

SCOP Domain Coordinates for d1nj5a1:

Click to download the PDB-style file with coordinates for d1nj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj5a1: