SCOPe 2.02: Domain d1nj2a2: 1nj2 A:411-481

Lineage for d1nj2a2 (1nj2 A:411-481)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family)
   contains a metal (zinc)-binding site

5. Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)

6. Protein C-terminal domain of ProRS [64588] (3 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [89973] (4 PDB entries)

8. Domain d1nj2a2: 1nj2 A:411-481 [85759]
   Other proteins in same PDB: d1nj2a1, d1nj2a3
   complexed with mg, zn

Details for d1nj2a2

PDB Entry: 1nj2, 3.11 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus

PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj2a2:

Sequence; same for both SEQRES and ATOM records:

>d1nj2a2 d.68.5.1 (A:411-481) C-terminal domain of ProRS {Methanothermobacter thermautotrophicus [TaxId: 145262]}
ireaetleeasrivdekrgiisfmwcgeeecgmdveekvrvdilgiqeegsgtcincgre
apyraylarty

Timeline for d1nj2a2:

• d1nj2a2 first appeared in SCOP 1.65
  
• d1nj2a2 appears in SCOPe 2.01
  
• d1nj2a2 appears in SCOPe 2.03
  
• d1nj2a2 appears in the current release, SCOPe 2.08