Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) contains a metal (zinc)-binding site |
Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein) |
Protein C-terminal domain of ProRS [64588] (3 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [89973] (4 PDB entries) |
Domain d1nj2a2: 1nj2 A:411-481 [85759] Other proteins in same PDB: d1nj2a1, d1nj2a3 complexed with mg, zn |
PDB Entry: 1nj2 (more details), 3.11 Å
SCOPe Domain Sequences for d1nj2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj2a2 d.68.5.1 (A:411-481) C-terminal domain of ProRS {Methanothermobacter thermautotrophicus [TaxId: 145262]} ireaetleeasrivdekrgiisfmwcgeeecgmdveekvrvdilgiqeegsgtcincgre apyraylarty
Timeline for d1nj2a2: