Lineage for d1nj1a3 (1nj1 A:19-283)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920823Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 1920829Species Methanothermobacter thermautotrophicus [TaxId:145262] [90009] (4 PDB entries)
  8. 1920830Domain d1nj1a3: 1nj1 A:19-283 [85757]
    Other proteins in same PDB: d1nj1a1, d1nj1a2
    protein/RNA complex; complexed with 5ca, mg, zn

Details for d1nj1a3

PDB Entry: 1nj1 (more details), 2.55 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to cysteine sulfamoyl adenylate
PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Methanothermobacter thermautotrophicus [TaxId: 145262]}
efsewfhnileeaeiidqrypvkgmhvwmphgfmirkntlkilrrildrdheevlfpllv
pedelakeaihvkgfedevywvthgglsklqrklalrptsetvmypmfalwvrshtdlpm
rfyqvvntfryetkhtrplirvreittfkeahtihataseaeeqveraveiykeffnslg
ipylitrrppwdkfpgseytvafdtlmpdgktlqigtvhnlgqtfartfeikfetpegdh
eyvhqtcyglsdrviasviaihgde

SCOPe Domain Coordinates for d1nj1a3:

Click to download the PDB-style file with coordinates for d1nj1a3.
(The format of our PDB-style files is described here.)

Timeline for d1nj1a3: