Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [90009] (4 PDB entries) |
Domain d1nj1a3: 1nj1 A:19-283 [85757] Other proteins in same PDB: d1nj1a1, d1nj1a2 protein/RNA complex; complexed with 5ca, mg, zn |
PDB Entry: 1nj1 (more details), 2.55 Å
SCOPe Domain Sequences for d1nj1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Methanothermobacter thermautotrophicus [TaxId: 145262]} efsewfhnileeaeiidqrypvkgmhvwmphgfmirkntlkilrrildrdheevlfpllv pedelakeaihvkgfedevywvthgglsklqrklalrptsetvmypmfalwvrshtdlpm rfyqvvntfryetkhtrplirvreittfkeahtihataseaeeqveraveiykeffnslg ipylitrrppwdkfpgseytvafdtlmpdgktlqigtvhnlgqtfartfeikfetpegdh eyvhqtcyglsdrviasviaihgde
Timeline for d1nj1a3: