Lineage for d1nj1a3 (1nj1 A:19-283)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509107Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 509108Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 509109Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 509214Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 509220Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [90009] (4 PDB entries)
  8. 509221Domain d1nj1a3: 1nj1 A:19-283 [85757]
    Other proteins in same PDB: d1nj1a1, d1nj1a2

Details for d1nj1a3

PDB Entry: 1nj1 (more details), 2.55 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to cysteine sulfamoyl adenylate

SCOP Domain Sequences for d1nj1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus)}
efsewfhnileeaeiidqrypvkgmhvwmphgfmirkntlkilrrildrdheevlfpllv
pedelakeaihvkgfedevywvthgglsklqrklalrptsetvmypmfalwvrshtdlpm
rfyqvvntfryetkhtrplirvreittfkeahtihataseaeeqveraveiykeffnslg
ipylitrrppwdkfpgseytvafdtlmpdgktlqigtvhnlgqtfartfeikfetpegdh
eyvhqtcyglsdrviasviaihgde

SCOP Domain Coordinates for d1nj1a3:

Click to download the PDB-style file with coordinates for d1nj1a3.
(The format of our PDB-style files is described here.)

Timeline for d1nj1a3: