Lineage for d1nj1a1 (1nj1 A:284-410)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489814Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 2489820Species Methanothermobacter thermautotrophicus [TaxId:145262] [89714] (4 PDB entries)
  8. 2489821Domain d1nj1a1: 1nj1 A:284-410 [85755]
    Other proteins in same PDB: d1nj1a2, d1nj1a3
    protein/RNA complex; complexed with 5ca, mg, zn

Details for d1nj1a1

PDB Entry: 1nj1 (more details), 2.55 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to cysteine sulfamoyl adenylate
PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj1a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

SCOPe Domain Coordinates for d1nj1a1:

Click to download the PDB-style file with coordinates for d1nj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj1a1: