Lineage for d1nikf_ (1nik F:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 527484Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 527485Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 527486Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 527487Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 527488Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (5 PDB entries)
  8. 527542Domain d1nikf_: 1nik F: [85748]

Details for d1nikf_

PDB Entry: 1nik (more details), 4.1 Å

PDB Description: wild type rna polymerase ii

SCOP Domain Sequences for d1nikf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nikf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1nikf_:

Click to download the PDB-style file with coordinates for d1nikf_.
(The format of our PDB-style files is described here.)

Timeline for d1nikf_: