SCOPe 2.08: Domain d1nikf_: 1nik F:

Lineage for d1nikf_ (1nik F:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1nikf_: 1nik F: [85748]
   complexed with zn

Details for d1nikf_

PDB Entry: 1nik, 4.1 Å

PDB Description: wild type rna polymerase ii

PDB Compounds: (F:) DNA-directed RNA polymerase I, II and III 23 kDa polypeptide

SCOPe Domain Sequences for d1nikf_:

Sequence; same for both SEQRES and ATOM records:

>d1nikf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d1nikf_:

• d1nikf_ first appeared in SCOP 1.65
  
• d1nikf_ appears in SCOPe 2.07