Lineage for d1ngme2 (1ngm E:156-240)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610724Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 610725Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 610726Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 610792Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (6 PDB entries)
  8. 610808Domain d1ngme2: 1ngm E:156-240 [85689]
    Other proteins in same PDB: d1ngmb_, d1ngmf_, d1ngmj_, d1ngmn_

Details for d1ngme2

PDB Entry: 1ngm (more details), 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

SCOP Domain Sequences for d1ngme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngme2 d.129.1.1 (E:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOP Domain Coordinates for d1ngme2:

Click to download the PDB-style file with coordinates for d1ngme2.
(The format of our PDB-style files is described here.)

Timeline for d1ngme2: