SCOP 1.71: Domain d1ngmb_: 1ngm B:

Lineage for d1ngmb_ (1ngm B:)

1. Root: SCOP 1.71

2. Class j: Peptides [58231] (116 folds)

3. Fold j.104: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90297] (1 superfamily)

4. Superfamily j.104.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90298] (1 family)

5. Family j.104.1.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90299] (1 protein)

6. Protein TBP-binding domain of the transcription factor IIIb Brf1 subunit [90300] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90301] (1 PDB entry)

8. Domain d1ngmb_: 1ngm B: [85687]
   Other proteins in same PDB: d1ngma1, d1ngma2, d1ngme1, d1ngme2, d1ngmi1, d1ngmi2, d1ngmm1, d1ngmm2

Details for d1ngmb_

PDB Entry: 1ngm, 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

SCOP Domain Sequences for d1ngmb_:

Sequence; same for both SEQRES and ATOM records:

>d1ngmb_ j.104.1.1 (B:) TBP-binding domain of the transcription factor IIIb Brf1 subunit {Baker's yeast (Saccharomyces cerevisiae)}
gsycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadf
lleqeskrlkqe

Timeline for d1ngmb_:

• d1ngmb_ first appeared in SCOP 1.65
  
• d1ngmb_ appears in SCOP 1.69
  
• d1ngmb_ appears in SCOP 1.73
  
• d1ngmb_ appears in the current release, SCOPe 2.08, called d1ngmb1