Lineage for d1ng3a2 (1ng3 A:219-306)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404207Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1404208Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1404336Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 1404374Protein Glycine oxidase ThiO [89843] (1 species)
  7. 1404375Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries)
  8. 1404382Domain d1ng3a2: 1ng3 A:219-306 [85663]
    Other proteins in same PDB: d1ng3a1, d1ng3b1
    complexed with aac, fad, po4

Details for d1ng3a2

PDB Entry: 1ng3 (more details), 2.6 Å

PDB Description: complex of thio (glycine oxidase) with acetyl-glycine
PDB Compounds: (A:) glycine oxidase

SCOPe Domain Sequences for d1ng3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng3a2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv
mkkaktmlppiqnmkvdrfwaglrpgtk

SCOPe Domain Coordinates for d1ng3a2:

Click to download the PDB-style file with coordinates for d1ng3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ng3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng3a1