Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
Protein Glycine oxidase ThiO [89843] (1 species) |
Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries) |
Domain d1ng3a2: 1ng3 A:219-306 [85663] Other proteins in same PDB: d1ng3a1, d1ng3b1 complexed with aac, fad, po4 |
PDB Entry: 1ng3 (more details), 2.6 Å
SCOPe Domain Sequences for d1ng3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng3a2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv mkkaktmlppiqnmkvdrfwaglrpgtk
Timeline for d1ng3a2: