SCOPe 2.08: Domain d1ng3a2: 1ng3 A:219-306

Lineage for d1ng3a2 (1ng3 A:219-306)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Glycine oxidase ThiO [89843] (1 species)

7. Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries)

8. Domain d1ng3a2: 1ng3 A:219-306 [85663]
   Other proteins in same PDB: d1ng3a1, d1ng3b1
   complexed with aac, fad, po4

Details for d1ng3a2

PDB Entry: 1ng3, 2.6 Å

PDB Description: complex of thio (glycine oxidase) with acetyl-glycine

PDB Compounds: (A:) glycine oxidase

SCOPe Domain Sequences for d1ng3a2:

Sequence; same for both SEQRES and ATOM records:

>d1ng3a2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv
mkkaktmlppiqnmkvdrfwaglrpgtk

Timeline for d1ng3a2:

• d1ng3a2 first appeared in SCOP 1.65
  
• d1ng3a2 appears in SCOPe 2.07