Lineage for d1nfgc1 (1nfg C:1-51,C:382-457)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561510Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1561511Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1561571Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 1561572Protein D-hydantoinase [75045] (4 species)
  7. 1561585Species Burkholderia pickettii [TaxId:329] [89437] (1 PDB entry)
  8. 1561588Domain d1nfgc1: 1nfg C:1-51,C:382-457 [85636]
    Other proteins in same PDB: d1nfga2, d1nfgb2, d1nfgc2, d1nfgd2
    complexed with zn

Details for d1nfgc1

PDB Entry: 1nfg (more details), 2.7 Å

PDB Description: Structure of D-hydantoinase
PDB Compounds: (C:) D-hydantoinase

SCOPe Domain Sequences for d1nfgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfgc1 b.92.1.3 (C:1-51,C:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}
mdiiikngtivtadgisradlgikdgkitqiggalgpaertidaagryvfpXiavgsdad
ivlwdpeaemvieqtamhnamdyssyeghkvkgvpktvllrgkvivdegsyvgeptdgkf
lkrrkykq

SCOPe Domain Coordinates for d1nfgc1:

Click to download the PDB-style file with coordinates for d1nfgc1.
(The format of our PDB-style files is described here.)

Timeline for d1nfgc1: