SCOP 1.73: Domain d1nf3c_: 1nf3 C:

Lineage for d1nf3c_ (1nf3 C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89316] (1 PDB entry)

8. Domain d1nf3c_: 1nf3 C: [85596]
   Other proteins in same PDB: d1nf3a_, d1nf3b_

Details for d1nf3c_

PDB Entry: 1nf3, 2.1 Å

PDB Description: structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6

PDB Compounds: (C:) par-6b

SCOP Domain Sequences for d1nf3c_:

Sequence; same for both SEQRES and ATOM records:

>d1nf3c_ b.36.1.1 (C:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Mouse (Mus musculus) [TaxId: 10090]}
ivismpqdfrpvssiidvdilpethrrvrlckygtekplgfyirdgssvrvtphglekvp
gifisrlvpgglaqstgllavndevlevngievsgksldqvtdmmiansrnliitvrpan
qrn

Timeline for d1nf3c_:

• d1nf3c_ first appeared in SCOP 1.65
  
• d1nf3c_ appears in SCOP 1.71
  
• d1nf3c_ appears in SCOP 1.75
  
• d1nf3c_ appears in the current release, SCOPe 2.08