SCOPe 2.07: Domain d1nf3a1: 1nf3 A:2-190

Lineage for d1nf3a1 (1nf3 A:2-190)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (33 PDB entries)

8. Domain d1nf3a1: 1nf3 A:2-190 [85594]
   Other proteins in same PDB: d1nf3a2, d1nf3b2, d1nf3c_, d1nf3d_
   complexed with gnp, mg

Details for d1nf3a1

PDB Entry: 1nf3, 2.1 Å

PDB Description: structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6

PDB Compounds: (A:) G25K GTP-binding protein, placental isoform

SCOPe Domain Sequences for d1nf3a1:

Sequence; same for both SEQRES and ATOM records:

>d1nf3a1 c.37.1.8 (A:2-190) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
qtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagl
edydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrd
dpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaaleppe
pkksrrcvl

Timeline for d1nf3a1:

• d1nf3a1 first appeared in SCOP 1.65, called d1nf3a_
  
• d1nf3a1 appears in SCOPe 2.06
  
• d1nf3a1 appears in the current release, SCOPe 2.08