SCOPe 2.02: Domain d1ncnb_: 1ncn B:

Lineage for d1ncnb_ (1ncn B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD86 (b7-2), N-terminal domain [63635] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63636] (2 PDB entries)

8. Domain d1ncnb_: 1ncn B: [85554]

Details for d1ncnb_

PDB Entry: 1ncn, 2.7 Å

PDB Description: the receptor-binding domain of human B7-2

PDB Compounds: (B:) t lymphocyte activation antigen cd86

SCOPe Domain Sequences for d1ncnb_:

Sequence; same for both SEQRES and ATOM records:

>d1ncnb_ b.1.1.1 (B:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

Timeline for d1ncnb_:

• d1ncnb_ first appeared in SCOP 1.65
  
• d1ncnb_ appears in SCOPe 2.01
  
• d1ncnb_ appears in SCOPe 2.03
  
• d1ncnb_ appears in the current release, SCOPe 2.08, called d1ncnb1