Lineage for d1nc5a_ (1nc5 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1742883Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1743050Family a.102.1.6: Hypothetical protein YteR [89108] (2 proteins)
    unknown function; weak sequence similarity to the catalytic domain of cellulases
    automatically mapped to Pfam PF07470
  6. 1743051Protein Hypothetical protein YteR [89109] (1 species)
  7. 1743052Species Bacillus subtilis [TaxId:1423] [89110] (2 PDB entries)
  8. 1743053Domain d1nc5a_: 1nc5 A: [85548]
    structural genomics

Details for d1nc5a_

PDB Entry: 1nc5 (more details), 1.6 Å

PDB Description: structure of protein of unknown function of yter from bacillus subtilis
PDB Compounds: (A:) hypothetical protein yTER

SCOPe Domain Sequences for d1nc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}
kspltyaealantimntytveelppanrwhyhqgvflcgvlrlweatgekryfeyakaya
dlliddngnllfrrdeldaiqaglilfplyeqtkderyvkaakrlrslygtlnrtseggf
whkdgypyqmwldglymggpfalkyanlkqetelfdqvvlqeslmrkhtkdaktglfyha
wdeakkmpwaneetgcspefwarsigwyvmsladmieelpkkhpnrhvwkntlqdmiksi
cryqdketglwyqivdkgdrsdnwlessgsclymyaiakginkgyldrayettllkayqg
liqhktetsedgaflvkdicvgtsagfydyyvsrerstndlhgagafilamteleplfrs
agk

SCOPe Domain Coordinates for d1nc5a_:

Click to download the PDB-style file with coordinates for d1nc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1nc5a_: