Lineage for d1n9na_ (1n9n A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038114Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1038226Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 1038240Protein Putative blue light receptor, phot-lov1 domain [90017] (1 species)
  7. 1038241Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [90018] (3 PDB entries)
  8. 1038243Domain d1n9na_: 1n9n A: [85469]
    complexed with fmn

Details for d1n9na_

PDB Entry: 1n9n (more details), 2.3 Å

PDB Description: crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. data set of a single crystal.
PDB Compounds: (A:) putative blue light receptor

SCOPe Domain Sequences for d1n9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9na_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
lrhtfvvadatlpdcplvyasegfyamtgygpdevlghncrflqgegtdpkevqkirdai
kkgeacsvrllnyrkdgtpfwnlltvtpiktpdgrvskfvgvqvdvts

SCOPe Domain Coordinates for d1n9na_:

Click to download the PDB-style file with coordinates for d1n9na_.
(The format of our PDB-style files is described here.)

Timeline for d1n9na_: