Lineage for d1n9ba_ (1n9b A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450242Protein beta-Lactamase, class A [56606] (16 species)
  7. 1450361Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (10 PDB entries)
    almost identical sequence to SHV-1
  8. 1450362Domain d1n9ba_: 1n9b A: [85463]
    complexed with epe, ma4, mpd

Details for d1n9ba_

PDB Entry: 1n9b (more details), 0.9 Å

PDB Description: ultrahigh resolution structure of a class a beta-lactamase: on the mechanism and specificity of the extended-spectrum shv-2 enzyme
PDB Compounds: (A:) beta-lactamase shv-2

SCOPe Domain Sequences for d1n9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgasergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d1n9ba_:

Click to download the PDB-style file with coordinates for d1n9ba_.
(The format of our PDB-style files is described here.)

Timeline for d1n9ba_: