| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein beta-Lactamase, class A [56606] (16 species) |
| Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (10 PDB entries) almost identical sequence to SHV-1 |
| Domain d1n9ba_: 1n9b A: [85463] complexed with epe, ma4, mpd |
PDB Entry: 1n9b (more details), 0.9 Å
SCOPe Domain Sequences for d1n9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgasergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr
Timeline for d1n9ba_: