SCOPe 2.08: Domain d1n8ry_: 1n8r Y:

Lineage for d1n8ry_ (1n8r Y:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)
   automatically mapped to Pfam PF01198

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
   Uniprot P18138

8. Domain d1n8ry_: 1n8r Y: [85452]
   Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8rz_
   complexed with cd, cl, k, mg, na, vir

Details for d1n8ry_

PDB Entry: 1n8r, 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

PDB Compounds: (Y:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1n8ry_:

Sequence; same for both SEQRES and ATOM records:

>d1n8ry_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1n8ry_:

• d1n8ry_ first appeared in SCOP 1.65
  
• d1n8ry_ appears in SCOPe 2.07