Lineage for d1n8rz_ (1n8r Z:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851574Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2851575Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2851576Protein Ribosomal protein L32e [52044] (1 species)
  7. 2851577Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2851602Domain d1n8rz_: 1n8r Z: [85453]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_
    complexed with cd, cl, k, mg, na, vir

Details for d1n8rz_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (Z:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1n8rz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rz_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1n8rz_:

Click to download the PDB-style file with coordinates for d1n8rz_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rz_: