Lineage for d1n8qa2 (1n8q A:9-167)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529888Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 1529889Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 1529890Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 1529894Protein Plant lipoxigenase [49725] (2 species)
  7. 1529912Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (9 PDB entries)
    Uniprot P09186
  8. 1529914Domain d1n8qa2: 1n8q A:9-167 [85423]
    Other proteins in same PDB: d1n8qa1
    complexed with dhb, fe2

Details for d1n8qa2

PDB Entry: 1n8q (more details), 2.1 Å

PDB Description: lipoxygenase in complex with protocatechuic acid
PDB Compounds: (A:) lipoxygenase-3

SCOPe Domain Sequences for d1n8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8qa2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

SCOPe Domain Coordinates for d1n8qa2:

Click to download the PDB-style file with coordinates for d1n8qa2.
(The format of our PDB-style files is described here.)

Timeline for d1n8qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n8qa1