Lineage for d1n6va2 (1n6v A:110-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371989Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)
  7. 2371990Species Human (Homo sapiens) [TaxId:9606] [89200] (5 PDB entries)
  8. 2371998Domain d1n6va2: 1n6v A:110-210 [85366]
    Other proteins in same PDB: d1n6va3

Details for d1n6va2

PDB Entry: 1n6v (more details)

PDB Description: average structure of the interferon-binding ectodomain of the human type i interferon receptor
PDB Compounds: (A:) Interferon-alpha/beta receptor beta chain

SCOPe Domain Sequences for d1n6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6va2 b.1.2.1 (A:110-210) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqese

SCOPe Domain Coordinates for d1n6va2:

Click to download the PDB-style file with coordinates for d1n6va2.
(The format of our PDB-style files is described here.)

Timeline for d1n6va2: