SCOPe 2.08: Domain d1n4xm1: 1n4x M:0-110

Lineage for d1n4xm1 (1n4x M:0-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
   Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

8. Domain d1n4xm1: 1n4x M:0-110 [85327]
   Other proteins in same PDB: d1n4xh1, d1n4xh2, d1n4xh3, d1n4xi1, d1n4xi2, d1n4xi3, d1n4xl2, d1n4xm2
   part of scFv 1695
   complexed with cl

Details for d1n4xm1

PDB Entry: 1n4x, 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph

PDB Compounds: (M:) immunoglobulin kappa chain variable region

SCOPe Domain Sequences for d1n4xm1:

Sequence; same for both SEQRES and ATOM records:

>d1n4xm1 b.1.1.1 (M:0-110) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkle

Timeline for d1n4xm1:

• d1n4xm1 first appeared in SCOP 1.65, called d1n4xm_
  
• d1n4xm1 appears in SCOPe 2.07