PDB entry 1n4x

View 1n4x on RCSB PDB site
Description: Structure of scFv 1696 at acidic pH
Class: immune system
Keywords: immunoglobulin, Immune system
Deposited on 2002-11-02, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain variable region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q921A6 (3-116)
      • cloning artifact (0-2)
      • cloning artifact (117-119)
    Domains in SCOPe 2.08: d1n4xh1, d1n4xh2, d1n4xh3
  • Chain 'I':
    Compound: immunoglobulin heavy chain variable region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q921A6 (3-116)
      • cloning artifact (0-2)
      • cloning artifact (117-118)
    Domains in SCOPe 2.08: d1n4xi1, d1n4xi2, d1n4xi3
  • Chain 'L':
    Compound: immunoglobulin kappa chain variable region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99M37 (1-110)
      • initiating met (0)
      • cloning artifact (111-112)
    Domains in SCOPe 2.08: d1n4xl1, d1n4xl2
  • Chain 'M':
    Compound: immunoglobulin kappa chain variable region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99M37 (1-110)
      • initiating met (0)
      • cloning artifact (111-112)
    Domains in SCOPe 2.08: d1n4xm1, d1n4xm2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xH (H:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n4xI (I:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4xI (I:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xL (L:)
    mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xM (M:)
    mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia