SCOP 1.73: Domain d1n3nc1: 1n3n C:182-276

Lineage for d1n3nc1 (1n3n C:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1n3nc1: 1n3n C:182-276 [85306]
   Other proteins in same PDB: d1n3na2, d1n3nb_, d1n3nc2, d1n3nd_, d1n3ne2, d1n3nf_, d1n3ng2, d1n3nh_

Details for d1n3nc1

PDB Entry: 1n3n, 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db

PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1n3nc1:

Sequence; same for both SEQRES and ATOM records:

>d1n3nc1 b.1.1.2 (C:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1n3nc1:

• d1n3nc1 first appeared in SCOP 1.65
  
• d1n3nc1 appears in SCOP 1.71
  
• d1n3nc1 appears in SCOP 1.75
  
• d1n3nc1 appears in the current release, SCOPe 2.08