Lineage for d1n3ng1 (1n3n G:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654832Domain d1n3ng1: 1n3n G:182-276 [85312]
    Other proteins in same PDB: d1n3na2, d1n3nb_, d1n3nc2, d1n3nd_, d1n3ne2, d1n3nf_, d1n3ng2, d1n3nh_
    complexed with so4

Details for d1n3ng1

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1n3ng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3ng1 b.1.1.2 (G:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOP Domain Coordinates for d1n3ng1:

Click to download the PDB-style file with coordinates for d1n3ng1.
(The format of our PDB-style files is described here.)

Timeline for d1n3ng1: