Lineage for d1n3ca1 (1n3c A:136-325)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.96.1: DNA-glycosylase [48150] (5 families) 
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) 
Protein 8-oxoguanine glycosylase [48160] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48161] (12 PDB entries) 
Domain d1n3ca1: 1n3c A:136-325 [85293]
Other proteins in same PDB: d1n3ca2
complexed with 8og, ca; mutant
Details for d1n3ca1
PDB Entry: 1n3c (more details), 2.7 Å
PDB Description: structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase
SCOP Domain Sequences for d1n3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3ca1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq
SCOP Domain Coordinates for d1n3ca1:
Click to download the PDB-style file with coordinates for d1n3ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n3ca1:
- d1n3ca1 first appeared in SCOP 1.65
- d1n3ca1 appears in SCOP 1.69
- d1n3ca1 appears in the current release, SCOPe 2.08
View in 3D
